Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant African swine fever virus Uncharacterized protein A118R (Ba71V-035)

This Recombinant African swine fever virus Uncharacterized protein A118R (Ba71V-035) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein A118R

UniProt

Q65139

Expression Region

1-118

Origin

African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHSNAFFNLIACVLFPTPLIPSMVISIPRMINKWVKRVQFLTFLTNLFLYNIVQHYINRI RCYSFIKYLLLYNLYRPIFGRSLQMAITKIKIISDATAAVLLKSCAAMYDVLIDKKFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), 0.2mg/mL
BNUB1820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), 0.2mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF640R conjugate, 0.1mg/mL
BNC402040-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (CD30/412), CF488A conjugate, 0.1mg/mL
BNC880412-500 1x 500 µL

CD30 (CD30/412), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details