Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phage shock protein C (pspC)

This Recombinant Phage shock protein C (pspC) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Phage shock protein C

UniProt

P0AFN4

Expression Region

1-119

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Combretastatin B1
TBZ1177 unit

Combretastatin B1

Sign In for Pricing
View Details
Recombinant Neisseria gonorrhoeae Macrolide export ATP-binding/permease protein MacB (macB), partial
MBS7082196 Inquire

Recombinant Neisseria gonorrhoeae Macrolide export ATP-binding/permease protein MacB (macB), partial

Sign In for Pricing
View Details
Coro6 (NM_139115) Rat Tagged ORF Clone Lentiviral Particle
RR204362L4V 200 µL

Coro6 (NM_139115) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Framycetin  F  100 mcg
SD014-5VL 1 unit

Framycetin F 100 mcg

Sign In for Pricing
View Details
Human Monoclonal TRAILR2/TNFRSF10B Antibody (conatumumab) [Janelia Fluor 585]
NBP3-28319JF585 0.1 mL

Human Monoclonal TRAILR2/TNFRSF10B Antibody (conatumumab) [Janelia Fluor 585]

Sign In for Pricing
View Details
IL17A ELISA Kit (Mouse) (OKAN04919)
OKAN04919 96 Well

IL17A ELISA Kit (Mouse) (OKAN04919)

Sign In for Pricing
View Details