Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phage shock protein C (pspC)

This Recombinant Phage shock protein C (pspC) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Phage shock protein C

UniProt

P0AFN4

Expression Region

1-119

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase alpha Antibody
MBS9604545-01 0.1 mL

DNA Polymerase alpha Antibody

Sign In for Pricing
View Details
DNA Polymerase alpha Antibody
MBS9604545-02 0.2 mL

DNA Polymerase alpha Antibody

Sign In for Pricing
View Details
DNA Polymerase alpha Antibody
MBS9604545-03 5x 0.2 mL

DNA Polymerase alpha Antibody

Sign In for Pricing
View Details
Nip30 3'UTR Luciferase Stable Cell Line
TU213980 1.0 mL

Nip30 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FBXO39 antibody - middle region (ARP53144_P050)
ARP53144_P050 100 µL

FBXO39 antibody - middle region (ARP53144_P050)

Sign In for Pricing
View Details
Uracil-5-boronic acid
sc-264484A 1 g

Uracil-5-boronic acid

Sign In for Pricing
View Details