Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phage shock protein C (pspC)

This Recombinant Phage shock protein C (pspC) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Phage shock protein C

UniProt

P0AFN4

Expression Region

1-119

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Blocking Peptide
abx062373-01 1 mg

CD4 Blocking Peptide

Sign In for Pricing
View Details
CD4 Blocking Peptide
abx062373-02 5 mg

CD4 Blocking Peptide

Sign In for Pricing
View Details
OR10A2 Rabbit Polyclonal Antibody (HRP)
orb2085374 100 µL

OR10A2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
HTN3 (NM_000200) Human Tagged ORF Clone
RG203123 10 µg

HTN3 (NM_000200) Human Tagged ORF Clone

Sign In for Pricing
View Details
LCA5 AAV Vector (Rat) (CMV)
26337106 1 µg

LCA5 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
NANOG (Nanog Homeobox) (AP) discontinued
249125-AP 100 µL

NANOG (Nanog Homeobox) (AP) discontinued

Sign In for Pricing
View Details