Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6QGQ0

Expression Region

1-120

Origin

Staphylococcus aureus (strain Newman)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nebulette Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9468R-BF647-01 20 µL

Nebulette Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Nebulette Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9468R-BF647-02 100 µL

Nebulette Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
TCIRG1 Antibody
MBS7110103-01 0.05 mg

TCIRG1 Antibody

Sign In for Pricing
View Details
TCIRG1 Antibody
MBS7110103-02 0.1 mg

TCIRG1 Antibody

Sign In for Pricing
View Details
TCIRG1 Antibody
MBS7110103-03 5x 0.1 mg

TCIRG1 Antibody

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) BioAssayTM ELISA Kit (Mouse)
025399 96 Tests

Glutathione Synthetase (GSS) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details