Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NADH-ubiquinone oxidoreductase chain 3 (NAD3)

This Recombinant NADH-ubiquinone oxidoreductase chain 3 (NAD3) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

NADH-ubiquinone oxidoreductase chain 3, EC= 1.6.5.3, NADH dehydrogenase subunit 3

UniProt

O21273

Expression Region

1-122

Origin

Reclinomonas americana

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTMILSEYLSVLIFFIFSFGLSCIILGLSYVLATQNADTEKLSPYECGFNPFDDARGAF DVRFYLVAILFIIFDLEVAFLFPWAVALSDVTIFGFWTMFIFLLILTVGFIYEWKKGALD WE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF740 conjugate, 0.1mg/mL
BNC741148-500 1x 500 µL

CD45RA (PTPRC/1148), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details