Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti PhaF2 protein (phaF2)

This Recombinant Rhizobium meliloti PhaF2 protein (phaF2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

PhaF2 protein

UniProt

Q52965

Expression Region

1-123

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPAAVLSAASGVALVLLSLALLLTVLRIIRGPTLPDRVLGLDMLVAIAIGLIAVIAVRT GFYLYIDIAIALGLVGFLATVAFARFILARGLSPERRTPGTTEIPQAKPRPSQAGRRKRK GAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,5-Dibromoanthracene
TRC-B426453-50MG 50 mg

1,5-Dibromoanthracene

Sign In for Pricing
View Details
ATP11B Polyclonal Antibody
E-AB-90372-01 60 µL

ATP11B Polyclonal Antibody

Sign In for Pricing
View Details
ATP11B Polyclonal Antibody
E-AB-90372-02 120 µL

ATP11B Polyclonal Antibody

Sign In for Pricing
View Details
ATP11B Polyclonal Antibody
E-AB-90372-03 200 µL

ATP11B Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD80 Protein (Fc Tag)
PDMH100265-01 20 µg

Recombinant Human CD80 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD80 Protein (Fc Tag)
PDMH100265-02 100 µg

Recombinant Human CD80 Protein (Fc Tag)

Sign In for Pricing
View Details