Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar protein fliO (fliO)

This Recombinant Flagellar protein fliO (fliO) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Flagellar protein fliO

UniProt

P0A1L2

Expression Region

1-125

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKTEATVSQPTAPAGSPLMQVSGALIGIIALILAAAWVIKRMGFAPKGNSVRGLKVSAS ASLGPRERVVIVEVENARLVLGVTASQINLLHTLPPAENDTEAPVAPPADFQNMMKSLLK RSGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kdelr3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6113403 1.0 µg DNA

Kdelr3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Midostaurin-13C6
TRC-M343762-10MG 10 mg

Midostaurin-13C6

Sign In for Pricing
View Details
Apg10 Rabbit Polyclonal Antibody (RBITC)
orb1042738 100 µL

Apg10 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
SUSD5, CT (SUSD5, KIAA0527, Sushi domain-containing protein 5) (MaxLight 405) discontinued
042496-ML405 100 µL

SUSD5, CT (SUSD5, KIAA0527, Sushi domain-containing protein 5) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human VTI1A Protein, N-His
orb3058206-01 50 µg

Recombinant Human VTI1A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human VTI1A Protein, N-His
orb3058206-02 100 µg

Recombinant Human VTI1A Protein, N-His

Sign In for Pricing
View Details