Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar protein fliO (fliO)

This Recombinant Flagellar protein fliO (fliO) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Flagellar protein fliO

UniProt

P0A1L2

Expression Region

1-125

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKTEATVSQPTAPAGSPLMQVSGALIGIIALILAAAWVIKRMGFAPKGNSVRGLKVSAS ASLGPRERVVIVEVENARLVLGVTASQINLLHTLPPAENDTEAPVAPPADFQNMMKSLLK RSGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF4E1B HDR Plasmid (m)
sc-432288-HDR 20 µg

eIF4E1B HDR Plasmid (m)

Sign In for Pricing
View Details
MYF6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
31225066 1.0 µg DNA

MYF6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CDH19 Antibody
E310416 200 µL

CDH19 Antibody

Sign In for Pricing
View Details
HBZ (HBZ2, Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-globin) APC
MBS6136929-01 0.1 mL

HBZ (HBZ2, Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-globin) APC

Sign In for Pricing
View Details
HBZ (HBZ2, Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-globin) APC
MBS6136929-02 5x 0.1 mL

HBZ (HBZ2, Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-globin) APC

Sign In for Pricing
View Details
Anti-CHRNA4 Polyclonal Antibody
TMAB-04329-01 50 μL

Anti-CHRNA4 Polyclonal Antibody

Sign In for Pricing
View Details