Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

Q87KY1

Expression Region

1-125

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPNYSVNTSPKRSDEPIWWGLFGAGGTWFAMLTPITVLVLGILVPLGVIDAEAMSYERV SAFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVIGKVACYAFAGLITALAVI FIFMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL
BNC940883-100 1x 100 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details