Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

P67643

Expression Region

1-125

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW MLLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ro 41-1049 hydrochloride 2mg
A21672-2 2 mg

Ro 41-1049 hydrochloride 2mg

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Flavin carrier protein 2 (FLC2) , partial
MBS1225896-01 1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Flavin carrier protein 2 (FLC2) , partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Flavin carrier protein 2 (FLC2) , partial
MBS1225896-02 1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Flavin carrier protein 2 (FLC2) , partial

Sign In for Pricing
View Details
ARV1 Human Over-expression Lysate
orb1356418 100 µg

ARV1 Human Over-expression Lysate

Sign In for Pricing
View Details
N- (1,2,3,4-Tetrahydroquinolin-5-yl) methanesulfonamide
RQB71833-01 50 mg

N- (1,2,3,4-Tetrahydroquinolin-5-yl) methanesulfonamide

Sign In for Pricing
View Details
N- (1,2,3,4-Tetrahydroquinolin-5-yl) methanesulfonamide
RQB71833-02 0.5 g

N- (1,2,3,4-Tetrahydroquinolin-5-yl) methanesulfonamide

Sign In for Pricing
View Details