Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

P67643

Expression Region

1-125

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW MLLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP3 Rabbit Monoclonal Antibody
AMRe01854-01 1 Each

CRMP3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CRMP3 Rabbit Monoclonal Antibody
AMRe01854-02 50 µL

CRMP3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CRMP3 Rabbit Monoclonal Antibody
AMRe01854-03 100 µL

CRMP3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LOC100302372 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV641654 1.0 µg DNA

LOC100302372 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
GBX1 antibody
70R-3885 50 ug

GBX1 antibody

Sign In for Pricing
View Details
E2F Antibody
orb43483-01 50 μL

E2F Antibody

Sign In for Pricing
View Details