Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ATP synthase protein I (atpI)

This Recombinant Bacillus subtilis ATP synthase protein I (atpI) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P37816

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDPKLTFSRQRKYLLFILAVYVLGYGLTAYKTVFLGLILGTVFSLFNFLLLVRRMNAFD RAVEKGKSIRSLGSAARWCNAILAVAVAYKNPEYFHMASTVIGLMTIYPVIMIDSFIQLK RSSMEER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Plasma Kallikrein/KLKB1 EZ-Set™ ELISA Kit (DIY Antibody Pairs)
EZ2107 5 Plates/Kit

Mouse Plasma Kallikrein/KLKB1 EZ-Set™ ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
Thermostable USER III Enzyme
M5509S 50 Units

Thermostable USER III Enzyme

Sign In for Pricing
View Details
GLUD1 Antibody / Glutamate dehydrogenase 1
FY12988 100 µg

GLUD1 Antibody / Glutamate dehydrogenase 1

Sign In for Pricing
View Details
Goat Cell growth regulator with EF hand domain protein 1 (CGREF1) ELISA Kit
GTR10339717 96 Well

Goat Cell growth regulator with EF hand domain protein 1 (CGREF1) ELISA Kit

Sign In for Pricing
View Details
Human SEC14L1 shRNA Plasmid
abx954319-01 150 µg

Human SEC14L1 shRNA Plasmid

Sign In for Pricing
View Details
Human SEC14L1 shRNA Plasmid
abx954319-02 300 µg

Human SEC14L1 shRNA Plasmid

Sign In for Pricing
View Details