Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ATP synthase protein I (atpI)

This Recombinant Bacillus subtilis ATP synthase protein I (atpI) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

ATP synthase protein I

UniProt

P37816

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDPKLTFSRQRKYLLFILAVYVLGYGLTAYKTVFLGLILGTVFSLFNFLLLVRRMNAFD RAVEKGKSIRSLGSAARWCNAILAVAVAYKNPEYFHMASTVIGLMTIYPVIMIDSFIQLK RSSMEER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein FAM26D (FAM26D), partial
MBS7081860 Inquire

Recombinant Human Protein FAM26D (FAM26D), partial

Sign In for Pricing
View Details
GDNF Antibody
orb572592-01 50 μL

GDNF Antibody

Sign In for Pricing
View Details
GDNF Antibody
orb572592-02 100 µL

GDNF Antibody

Sign In for Pricing
View Details
Recombinant Human SH3GL3 Protein
E30P1786 20 µg

Recombinant Human SH3GL3 Protein

Sign In for Pricing
View Details
Phospho-LATS1 (Ser909) Rabbit Polyclonal Antibody (AP)
orb901834 100 µL

Phospho-LATS1 (Ser909) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Trdmt1 Mouse shRNA Lentiviral Particle (Locus ID 13434)
TL517373V 500 µL Each

Trdmt1 Mouse shRNA Lentiviral Particle (Locus ID 13434)

Sign In for Pricing
View Details