Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP)

This Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhP

UniProt

P54514

Expression Region

1-131

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIIIYFIVKYVMNRNAGSE GAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKPMILKKKSQTQLTVIEG KKNKKKNRALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803742 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Ptger3 Mouse Gene Knockout Kit (CRISPR)
KN514170 1 Kit

Ptger3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBAP1 Human Gene Knockout Kit (CRISPR)
KN401858 1 Kit

UBAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC10A2 (NM_000452) Human Over-expression Lysate
LY424708 100 µg

SLC10A2 (NM_000452) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ret activation kit by CRISPRa
GA203619 1 Kit

Mouse Ret activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF707 (NM_001288805) Human Tagged ORF Clone
RG237788 10 µg

ZNF707 (NM_001288805) Human Tagged ORF Clone

Sign In for Pricing
View Details