Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP)

This Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhP

UniProt

P54514

Expression Region

1-131

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIIIYFIVKYVMNRNAGSE GAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKPMILKKKSQTQLTVIEG KKNKKKNRALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (p120) (CTNNB1/2099), CF405S conjugate, 0.1mg/mL
BNC042099-500 1x 500 µL

Catenin, beta (p120) (CTNNB1/2099), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Isoleucine-13C6, 15N
TRC-I824088-5MG 5 mg

L-Isoleucine-13C6, 15N

Sign In for Pricing
View Details
Red Fluorescent SR In vivo Poly (active) Caspase (VAD) Assay
983 24 Tests

Red Fluorescent SR In vivo Poly (active) Caspase (VAD) Assay

Sign In for Pricing
View Details
DMAC2 (NM_001167870) Human Over-expression Lysate
LY432605 100 µg

DMAC2 (NM_001167870) Human Over-expression Lysate

Sign In for Pricing
View Details
Human BARX1 activation kit by CRISPRa
GA111089 1 Kit

Human BARX1 activation kit by CRISPRa

Sign In for Pricing
View Details
IGF1 Receptor (IGF1R) Rabbit Polyclonal Antibody
AP02621PU-N 100 µL

IGF1 Receptor (IGF1R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details