Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP)

This Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhP

UniProt

P54514

Expression Region

1-131

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIIIYFIVKYVMNRNAGSE GAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKPMILKKKSQTQLTVIEG KKNKKKNRALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-3 Antibody Pair Set
E-KAB-0675 50 µL & 100 µg

Human IL-3 Antibody Pair Set

Sign In for Pricing
View Details
PAK3 Rabbit Polyclonal Antibody
TA379590 100 µL

PAK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tnfrsf4 Mouse Gene Knockout Kit (CRISPR)
KN517990 1 Kit

Tnfrsf4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NARS1 Human Gene Knockout Kit (CRISPR)
KN400087 1 Kit

NARS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human BAFF Receptor (TNFRSF13C) activation kit by CRISPRa
GA114535 1 Kit

Human BAFF Receptor (TNFRSF13C) activation kit by CRISPRa

Sign In for Pricing
View Details
EMP3 (NM_001425) Human Over-expression Lysate
LC400554 20 µg

EMP3 (NM_001425) Human Over-expression Lysate

Sign In for Pricing
View Details