Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C4orf32 (C4orf32)

This Recombinant Human Uncharacterized protein C4orf32 (C4orf32) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Uncharacterized protein C4orf32

UniProt

Q8N8J7

Expression Region

1-132

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHT GEPVGDDYKKMGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLV AVLCLVIIYVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Phenetidine-d5 Hydrochloride
TRC-P296302-1MG 1 mg

p-Phenetidine-d5 Hydrochloride

Sign In for Pricing
View Details
CCN2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]
TA806802AM 100 µL

CCN2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]

Sign In for Pricing
View Details
1-Penten-3-one (contains 0.1% BHT stabiliser)
TRC-P274590-2.5G 2.5 g

1-Penten-3-one (contains 0.1% BHT stabiliser)

Sign In for Pricing
View Details
EIF4E pSer209 Rabbit Polyclonal Antibody
AP20836PU-N 100 µg

EIF4E pSer209 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Portable Refrigerator BPOR-201
BPOR-201 1 Unit

Portable Refrigerator BPOR-201

Sign In for Pricing
View Details
PWWP3A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA804374BM 100 µL

PWWP3A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details