Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf105 (C10orf105)

This Recombinant Human Uncharacterized protein C10orf105 (C10orf105) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf105

UniProt

Q8TEF2

Expression Region

1-133

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTEGPSLASSPAISPLAFLSAPVTPGTLAEATDPLPMLIALACIFLLLATCLLFMTLCK PAALDPSRRRAHECMPHHPGSPSEPQLRLWKRLGSLRLSLHSFRHGRPTVPRQPLPGPED NRSHCDYMESTKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GST-tag (rabbit antibody, polyclonal) - DyLight® 650 conjugated (40 µg)
AS17 4147-DL650 40 µg

Anti-GST-tag (rabbit antibody, polyclonal) - DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG Antibody
KC-1436-01 50 μL

Actin Regulatory Protein CAPG Antibody

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG Antibody
KC-1436-02 100 µL

Actin Regulatory Protein CAPG Antibody

Sign In for Pricing
View Details
Actin Regulatory Protein CAPG Antibody
KC-1436-03 1 mL

Actin Regulatory Protein CAPG Antibody

Sign In for Pricing
View Details
Chlorodiphenylphosphine
TRC-C377603-5G 5 g

Chlorodiphenylphosphine

Sign In for Pricing
View Details
Nonafluoro-1-butanesulfonic Acid
TRC-N649325-5G 5 g

Nonafluoro-1-butanesulfonic Acid

Sign In for Pricing
View Details