Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf105 (C10orf105)

This Recombinant Human Uncharacterized protein C10orf105 (C10orf105) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf105

UniProt

Q8TEF2

Expression Region

1-133

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTEGPSLASSPAISPLAFLSAPVTPGTLAEATDPLPMLIALACIFLLLATCLLFMTLCK PAALDPSRRRAHECMPHHPGSPSEPQLRLWKRLGSLRLSLHSFRHGRPTVPRQPLPGPED NRSHCDYMESTKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-7 Antibody Pair Set
E-KAB-0479 50 µL & 100 µg

Human IL-7 Antibody Pair Set

Sign In for Pricing
View Details
CDCA8 Mouse Monoclonal Antibody [Clone ID: OTI5A6]
CF807725 100 µg

CDCA8 Mouse Monoclonal Antibody [Clone ID: OTI5A6]

Sign In for Pricing
View Details
Human FOLR1 Recombinant Rabbit monoclonal Antibody
HA723356B 100 µL

Human FOLR1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS804141 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
Mouse Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit
RD-CD40L-Mu-01 96 Tests

Mouse Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details
Mouse Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit
RD-CD40L-Mu-02 48 Tests

Mouse Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details