Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon-induced transmembrane protein 5 (Ifitm5)

This Recombinant Mouse Interferon-induced transmembrane protein 5 (Ifitm5) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 5, Bone-restricted interferon-induced transmembrane protein-like protein, Bril, Fragilis family member 4

UniProt

O88728

Expression Region

1-134

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALV HSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDS AAFFSTKFDEEDYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX4, ID (Paired Box Protein Pax-4) (AP) discontinued
P3113-83K-AP 200 µL

PAX4, ID (Paired Box Protein Pax-4) (AP) discontinued

Sign In for Pricing
View Details
Ric8 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4775304 1.0 µg DNA

Ric8 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
KDM4B/JMJD2B Recombinant Rabbit mAb
ARM1266-01 30 µL

KDM4B/JMJD2B Recombinant Rabbit mAb

Sign In for Pricing
View Details
KDM4B/JMJD2B Recombinant Rabbit mAb
ARM1266-02 50 μL

KDM4B/JMJD2B Recombinant Rabbit mAb

Sign In for Pricing
View Details
KDM4B/JMJD2B Recombinant Rabbit mAb
ARM1266-03 100 µL

KDM4B/JMJD2B Recombinant Rabbit mAb

Sign In for Pricing
View Details
Cdk4 Mouse qPCR Primer Pair (NM_009870)
MP203121 200 Reactions

Cdk4 Mouse qPCR Primer Pair (NM_009870)

Sign In for Pricing
View Details