Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon-induced transmembrane protein 5 (Ifitm5)

This Recombinant Mouse Interferon-induced transmembrane protein 5 (Ifitm5) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 5, Bone-restricted interferon-induced transmembrane protein-like protein, Bril, Fragilis family member 4

UniProt

O88728

Expression Region

1-134

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALV HSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDS AAFFSTKFDEEDYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS10P22-set siRNA/shRNA/RNAi Lentivector (Human)
42027091 4x 500 ng

RPS10P22-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ValS Antibody
orb833003 2 mg

ValS Antibody

Sign In for Pricing
View Details
G6Pase-α Double Nickase Plasmid (h)
sc-417963-NIC 20 µg

G6Pase-α Double Nickase Plasmid (h)

Sign In for Pricing
View Details
KATNA1 Knockout NCI-H1299 Polyclonal Cells
ARG30888 1 Million

KATNA1 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Apilimod mesylate
C07320-5mg 5 mg

Apilimod mesylate

Sign In for Pricing
View Details
4-Nitrophenyl phosphate di(tris)salt
RM7311-1G 1 unit

4-Nitrophenyl phosphate di(tris)salt

Sign In for Pricing
View Details