Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon-induced transmembrane protein 5 (Ifitm5)

This Recombinant Mouse Interferon-induced transmembrane protein 5 (Ifitm5) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 5, Bone-restricted interferon-induced transmembrane protein-like protein, Bril, Fragilis family member 4

UniProt

O88728

Expression Region

1-134

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALV HSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDS AAFFSTKFDEEDYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal FBX09 Antibody
H00026268-B01P 50 µg

Mouse Polyclonal FBX09 Antibody

Sign In for Pricing
View Details
Anti-EGFR [2F8 (Zalutumumab; HuMax-EGFR)], Human IgG1
MBS488934-01 0.2 mg

Anti-EGFR [2F8 (Zalutumumab; HuMax-EGFR)], Human IgG1

Sign In for Pricing
View Details
Anti-EGFR [2F8 (Zalutumumab; HuMax-EGFR)], Human IgG1
MBS488934-02 5x 0.2 mg

Anti-EGFR [2F8 (Zalutumumab; HuMax-EGFR)], Human IgG1

Sign In for Pricing
View Details
Snrpd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4977406 1.0 µg DNA

Snrpd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
DCN Antibody
orb1410012-01 20 µg

DCN Antibody

Sign In for Pricing
View Details
DCN Antibody
orb1410012-02 100 µg

DCN Antibody

Sign In for Pricing
View Details