Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 type B (CYB5B)

This Recombinant Human Cytochrome b5 type B (CYB5B) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

O43169

Expression Region

12-146

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTSESKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC class I Recombinant Rabbit Monoclonal Antibody [JF10-38]
ET1702-47 100 µL

MHC class I Recombinant Rabbit Monoclonal Antibody [JF10-38]

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-404-01 50 μL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-404-02 100 µL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-404-03 1 mL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
TentaGel® M OH
M301000.5G 5 g

TentaGel® M OH

Sign In for Pricing
View Details
FOXI1 (NM_012188) Human Over-expression Lysate
LC402162 20 µg

FOXI1 (NM_012188) Human Over-expression Lysate

Sign In for Pricing
View Details