Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 type B (CYB5B)

This Recombinant Human Cytochrome b5 type B (CYB5B) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

O43169

Expression Region

12-146

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTSESKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM18 Human Gene Knockout Kit (CRISPR)
KN400878 1 Kit

RBM18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pure Triticum vulgare Lectin (Wheat Germ) -WGA-
L-2101-25 25 mg

Pure Triticum vulgare Lectin (Wheat Germ) -WGA-

Sign In for Pricing
View Details
HTR3B Rabbit Polyclonal Antibody
AP54751PU-N 100 µg

HTR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Agtr1b Mouse Gene Knockout Kit (CRISPR)
KN501000 1 Kit

Agtr1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD27 Antibody
KC-16215-01 50 μL

CD27 Antibody

Sign In for Pricing
View Details
CD27 Antibody
KC-16215-02 100 µL

CD27 Antibody

Sign In for Pricing
View Details