Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 type B (CYB5B)

This Recombinant Human Cytochrome b5 type B (CYB5B) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

O43169

Expression Region

12-146

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTSESKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycidamide
TRC-G615250-500MG 500 mg

Glycidamide

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), Biotin conjugate, 0.1mg/mL
BNCB2240-500 1x 500 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF568 conjugate, 0.1mg/mL
BNC683339-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS509150 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Flutrimazole
TRC-F622000-500MG 500 mg

Flutrimazole

Sign In for Pricing
View Details
Recombinant Human BMP-16 protein (His Tag)
PKSH034141-01 20 µg

Recombinant Human BMP-16 protein (His Tag)

Sign In for Pricing
View Details