Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi B Large-conductance mechanosensitive channel (mscL)

This Recombinant Salmonella paratyphi B Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A9N8B5

Expression Region

1-137

Origin

Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF594 conjugate, 0.1mg/mL
BNC942156-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details