Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

Q88FH7

Expression Region

1-137

Origin

Pseudomonas putida (strain KT2440)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARL RLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGA LDWAPEGRRKRQAKLKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL
BNC680773-100 1x 100 µL

CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF640R conjugate, 0.1mg/mL
BNC401948-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF488A conjugate, 0.1mg/mL
BNC881922-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details