Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Succinate dehydrogenase cytochrome b560 subunit (SDH3)

This Recombinant Marchantia polymorpha Succinate dehydrogenase cytochrome b560 subunit (SDH3) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Succinate dehydrogenase cytochrome b560 subunit, Succinate dehydrogenase, subunit III

UniProt

P35721

Expression Region

1-137

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKINRPLSPHLTIYKPQLTSTFSIFHRISGAFLATMVLFSILFFKIGDLSLTFYHFYQYF FFLTFYLNWFIISLVNFTLLALCYHMSNGVRHLLWDLGFFLELSKVYTSGIIMLFCAAFL ALLNIIRQHWSNGQIPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF568 conjugate, 0.1mg/mL
BNC681555-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tal1 (BTL73), CF640R conjugate, 0.1mg/mL
BNC402852-500 1x 500 µL

Tal1 (BTL73), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF647 conjugate, 0.1mg/mL
BNC471700-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details