Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella bacilliformis Large-conductance mechanosensitive channel (mscL)

This Recombinant Bartonella bacilliformis Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A1URL2

Expression Region

1-138

Origin

Bartonella bacilliformis (strain ATCC 35685 / KC583)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKQFALKGNMVDLAVGVIIGSAFGGLVNSVVNDIFMPIIGLITGGIDFSNMFIQLA GDKKATLLAAKEAGATLSYGNFITLLINFLIISWILFFLVKGMNKMTQKQEEVEKPKEMS PEGKLLTEIRDLLAAQKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF640R conjugate, 0.1mg/mL
BNC400563-500 1x 500 µL

Cytokeratin 18 (DE-K18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL
BNC680779-500 1x 500 µL

CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL
BNC880028-100 1x 100 µL

CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details