Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1999 (AF_1999)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1999 (AF_1999) spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1999

UniProt

O28280

Expression Region

1-138

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRDMIWTYRALNNPAARRKWTAFILLIVLAGFGYTAYKIAGGAEVGKSLIAAAIFALFIS LYAIITLGKPRHYYIEGDYVYYRPFKTNLKDIEGFEVDEERRVIRLKGAGIFSVRTLYFD NEDDLRQAVRRLERIVKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF488A conjugate, 0.1mg/mL
BNC882063-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF568 conjugate, 0.1mg/mL
BNC682324-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CA72/733), CF640R conjugate, 0.1mg/mL
BNC400733-100 1x 100 µL

TAG-72 / CA72.4 (CA72/733), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF640R conjugate, 0.1mg/mL
BNC402419-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF640R conjugate, 0.1mg/mL
BNC401125-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details