Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage P2 Protein lysA (lysA)

This Recombinant Enterobacteria phage P2 Protein lysA (lysA) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Protein lysA

UniProt

P51769

Expression Region

1-141

Origin

Enterobacteria phage P2 (Bacteriophage P2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLSLSLMLNVSLALMLALSLIYPQSVAVNFVAAWAILATVICVVAGGVGVYATEYVLE RYGRELPPESLAVKIVTSLFLQPVPWRRRAAALVVVVATFISLVAAGWIFTALIYLVVSL FFRLIRKACRQRLEGREPCQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIF sgRNA CRISPR Lentivector (Human) (Target 2)
K0857003 1.0 µg DNA

GIF sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
2-Methoxy-5-nitroformanilide
M3255-10 500 mg

2-Methoxy-5-nitroformanilide

Sign In for Pricing
View Details
Coumarin 343 azide
A8110-25 25 mg

Coumarin 343 azide

Sign In for Pricing
View Details
APC anti-mouse CD106
E16FMA106-100U 100 µg

APC anti-mouse CD106

Sign In for Pricing
View Details
A1BG Protein Lysate (Rat) with C-HA Tag
10917036 100 µg

A1BG Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
IL17A Antibody : HRP (OABF00921-HRP)
OABF00921-HRP 100 µL

IL17A Antibody : HRP (OABF00921-HRP)

Sign In for Pricing
View Details