Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yqaA (yqaA)

This Recombinant Inner membrane protein yqaA (yqaA) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Inner membrane protein yqaA

UniProt

P0ADR1

Expression Region

1-142

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVI LGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLC LGKALRYVAVAAATVQGMMWWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOMC00027-25MG - Ascomycin
OOMC00027-25MG 25 mg

OOMC00027-25MG - Ascomycin

Sign In for Pricing
View Details
Cypt12 CRISPR Activation Plasmid (m)
sc-429080-ACT 20 µg

Cypt12 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Human Growth Differentiation Factor 11 (GDF11) ELISA Kit
EK14195 48 Tests

Human Growth Differentiation Factor 11 (GDF11) ELISA Kit

Sign In for Pricing
View Details
Chlorouvedalin
MBS5787053 Inquire

Chlorouvedalin

Sign In for Pricing
View Details
Porcine Plg ELISA Kit
EPP0134 96 Tests

Porcine Plg ELISA Kit

Sign In for Pricing
View Details
Anti-MCM-BP Antibody
CQA1156-01 30 µL

Anti-MCM-BP Antibody

Sign In for Pricing
View Details