Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yqaA (yqaA)

This Recombinant Inner membrane protein yqaA (yqaA) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Inner membrane protein yqaA

UniProt

P0ADR1

Expression Region

1-142

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVI LGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLC LGKALRYVAVAAATVQGMMWWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CD80 shRNA (UAS) - Lentiviral human CD80 shRNA (UAS) plasmid
GTR15310498 1 Vial

Lentiviral human CD80 shRNA (UAS) - Lentiviral human CD80 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Olfr639 sgRNA CRISPR Lentivector set (Mouse)
K4136101 3x 1.0 µg

Olfr639 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein
abx067907-01 10 µg

Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein

Sign In for Pricing
View Details
Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein
abx067907-02 50 µg

Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein

Sign In for Pricing
View Details
Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein
abx067907-03 100 µg

Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein

Sign In for Pricing
View Details
Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein
abx067907-04 200 µg

Mouse Macrophage Stimulating 1 Receptor (MST1R) Protein

Sign In for Pricing
View Details