Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ninjurin-2 (Ninj2)

This Recombinant Mouse Ninjurin-2 (Ninj2) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Ninjurin-2, Nerve injury-induced protein 2

UniProt

Q9JL89

Expression Region

1-143

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESDRETIHLQHRHSMRGGNQRIDLNFYATKKSVAESMLDVALFMSNAMRLKSVLQQGPF AEYYTTLVTLIIVSLLLQVVISLLLVFIAILNLNEVENQRHLNKLNNAATILVFITVVIN IFITAFGAHHAASMAARTSSNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stathmin 1 (Oncoprotein 18, STMN1) (Biotin) discontinued
S7972-51D-Biotin 100 µL

Stathmin 1 (Oncoprotein 18, STMN1) (Biotin) discontinued

Sign In for Pricing
View Details
NKAP Protein Vector (Mouse) (pPB-C-His)
PV205606 500 ng

NKAP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
B2-Microglobulin (b2M) (MaxLight 750) discontinued
M3890-01A-ML750 100 µL

B2-Microglobulin (b2M) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Baiap2 Pre-designed siRNA Set A
SI101314A 1 Each

Mouse Baiap2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Anti-CD3e Rabbit mAb
CMA9108-01 30 µL

Recombinant Anti-CD3e Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CD3e Rabbit mAb
CMA9108-02 50 μL

Recombinant Anti-CD3e Rabbit mAb

Sign In for Pricing
View Details