Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ninjurin-2 (Ninj2)

This Recombinant Mouse Ninjurin-2 (Ninj2) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Ninjurin-2, Nerve injury-induced protein 2

UniProt

Q9JL89

Expression Region

1-143

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESDRETIHLQHRHSMRGGNQRIDLNFYATKKSVAESMLDVALFMSNAMRLKSVLQQGPF AEYYTTLVTLIIVSLLLQVVISLLLVFIAILNLNEVENQRHLNKLNNAATILVFITVVIN IFITAFGAHHAASMAARTSSNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLNS1A Recombinant Protein
PROTP54105-500ug 500 µg

Human CLNS1A Recombinant Protein

Sign In for Pricing
View Details
Bottle Alpha 60ml Glass
BOT2020 127 / PCK

Bottle Alpha 60ml Glass

Sign In for Pricing
View Details
MSE (ENolase, Muscle Specific, ENO3, Beta Enolase, Enolase 3, 2-phospho-D-glycerate hydro-lyase, Skeletal muscle enolase)
364215 200 µL

MSE (ENolase, Muscle Specific, ENO3, Beta Enolase, Enolase 3, 2-phospho-D-glycerate hydro-lyase, Skeletal muscle enolase)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG349 homolog (MPN_525)
MBS1004481-01 0.02 mg (E-Coli)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG349 homolog (MPN_525)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG349 homolog (MPN_525)
MBS1004481-02 0.02 mg (Yeast)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG349 homolog (MPN_525)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG349 homolog (MPN_525)
MBS1004481-03 0.1 mg (E-Coli)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG349 homolog (MPN_525)

Sign In for Pricing
View Details