Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Copper transporter 5 (COPT5)

This Recombinant Arabidopsis thaliana Copper transporter 5 (COPT5) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Copper transporter 5, AtCOPT5

UniProt

Q93VM8

Expression Region

1-146

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMHMTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLENRRIQFKSLSSSRRA PPPPRSSSGVSAPLIPKSGTRSAAKAASVLLFGVNAAIGYLLMLAAMSFNGGVFIAIVVG LTAGYAVFRSDDGGADTATDDPCPCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF647 conjugate, 0.1mg/mL
BNC472037-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL
BNC040795-100 1x 100 µL

CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF488A conjugate, 0.1mg/mL
BNC881130-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (MUC18/1130), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details