Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Plasminogen receptor (KT)

This Recombinant Mouse Plasminogen receptor (KT) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Plasminogen receptor (KT), Plg-R (KT)

UniProt

Q9D3P8

Expression Region

1-147

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLEKARREQSKLFSDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC6 CRISPRa sgRNA lentivector (set of three targets)(Human)
15634121 3x 1.0µg DNA

CDC6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
NRL (NM_006177) Human Over-expression Lysate
E45H08071-2 20 µg

NRL (NM_006177) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha-Guanosine
MBS5827228 Inquire

alpha-Guanosine

Sign In for Pricing
View Details
Recombinant Rat APCS/SAP Protein (His Tag)
PKSR030379 100 µg

Recombinant Rat APCS/SAP Protein (His Tag)

Sign In for Pricing
View Details
SETD6 (NM_024860) Human Untagged Clone
SC305166 10 µg

SETD6 (NM_024860) Human Untagged Clone

Sign In for Pricing
View Details
Anti-EIF2B1 Antibody Picoband®, iFluor647 Conjugate
A04239-1-iFluor647 100 µg

Anti-EIF2B1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details