Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Plasminogen receptor (KT)

This Recombinant Mouse Plasminogen receptor (KT) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Plasminogen receptor (KT), Plg-R (KT)

UniProt

Q9D3P8

Expression Region

1-147

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLEKARREQSKLFSDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-5-chloro-2,1,3-benzothiadiazole
TRC-A603430-1G 1 g

4-Amino-5-chloro-2,1,3-benzothiadiazole

Sign In for Pricing
View Details
HLA-DRB8 sgRNA CRISPR Lentivector (Human) (Target 1)
K0965902 1.0 µg DNA

HLA-DRB8 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ENPP2 Rabbit Polyclonal Antibody
TA356412 100 µL

ENPP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
13-Dioxolane - 1ML
S-1725 1 mL

13-Dioxolane - 1ML

Sign In for Pricing
View Details
2-Mercaptophenylacetic Acid
sc-209210 100 mg

2-Mercaptophenylacetic Acid

Sign In for Pricing
View Details
Lentiviral human CRYBB2 shRNA (UAS) - Lentiviral human CRYBB2 shRNA (UAS, GFP) plasmid
GTR15149302 1 Vial

Lentiviral human CRYBB2 shRNA (UAS) - Lentiviral human CRYBB2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details