Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Plasminogen receptor (KT)

This Recombinant Mouse Plasminogen receptor (KT) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Plasminogen receptor (KT), Plg-R (KT)

UniProt

Q9D3P8

Expression Region

1-147

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLEKARREQSKLFSDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (Western Blot) 120ul
IRBAHUEGFRAP034120UL 120 µL

Rabbit Anti Human EGFR Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (Western Blot) 120ul

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS536071 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
RA21062-01 50 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
RA21062-02 100 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
TSSC4 3'UTR Luciferase Stable Cell Line
TU027369 1.0 mL

TSSC4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ERVE-2 Protein Vector (Human) (pPB-N-His)
PV075906 500 ng

ERVE-2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details