Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yngA (yngA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yngA (yngA) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yngA

UniProt

O31821

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATRIFYEGRFVTLKEKIKTLGRFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTA GIVNSYVWNRNWTFCVKRKADGKEIVRFLMINIAASGITFLLLYLFQNCGCSLLVSKLAA TIGGMMMNFIGNRIWVFGDSLKNIQDQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRED1 (HRP)
577711-01 50 µg

SPRED1 (HRP)

Sign In for Pricing
View Details
SPRED1 (HRP)
577711-02 100 µg

SPRED1 (HRP)

Sign In for Pricing
View Details
Anti-DDB1 Antibody Picoband® (FITC Conjugate)
PB9578-FITC 100 µg/Vial

Anti-DDB1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (HRP)
MBS6369103-01 0.1 mL

AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (HRP)

Sign In for Pricing
View Details
AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (HRP)
MBS6369103-02 5x 0.1 mL

AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (HRP)

Sign In for Pricing
View Details
C1orf51 Antibody
GWB-MS755H 50 µg

C1orf51 Antibody

Sign In for Pricing
View Details