Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC)

This Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

Oligosaccharyltransferase complex subunit OSTC

UniProt

P86218

Expression Region

1-149

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COBRA1 Antibody (Center)
orb32984-01 50 µL

COBRA1 Antibody (Center)

Sign In for Pricing
View Details
COBRA1 Antibody (Center)
orb32984-02 100 µL

COBRA1 Antibody (Center)

Sign In for Pricing
View Details
SEPT10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
52018111 3x 1.0 µg

SEPT10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Pleated Cartridge, Polypro,3μm, Chem,5", OD:69mm,226/Fin, Polypro, EPDM, Standard, Rev.0
CFPPP0300C050AG1PES0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Pleated Cartridge, Polypro,3μm, Chem,5", OD:69mm,226/Fin, Polypro, EPDM, Standard, Rev.0

Sign In for Pricing
View Details
OLR1 Antibody
MBS7124996-01 0.05 mL

OLR1 Antibody

Sign In for Pricing
View Details
OLR1 Antibody
MBS7124996-02 0.1 mL

OLR1 Antibody

Sign In for Pricing
View Details