Recombinant Mycobacterium bovis Large-conductance mechanosensitive channel (mscL)
This Recombinant Mycobacterium bovis Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-151.
Product Specifications
Product Name Alternative
Large-conductance mechanosensitive channel
UniProt
A1KHC1
Expression Region
1-151
Origin
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIG IGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDL LAQTNGDSPGRHGGRGTPSPTDGPLASTESQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040158-100 1x 100 µL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880683-500 1x 500 µL
Cytokeratin 7 (OV-TL12/30), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details