Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Microsomal glutathione S-transferase 3 (MGST3)

This Recombinant Bovine Microsomal glutathione S-transferase 3 (MGST3) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Microsomal glutathione S-transferase 3, Microsomal GST-3, EC= 2.5.1.18

UniProt

Q3T100

Expression Region

1-152

Origin

Bos taurus (Bovine)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPENGHIFNCIQRA HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRGALSFI ALIGLMGTTVCSAFQHLGWVRTGLNSGCKSCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details