Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein C19orf12 (C19orf12)

This Recombinant Human Protein C19orf12 (C19orf12) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Protein C19orf12

UniProt

Q9NSK7

Expression Region

1-152

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPP GLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTA LVMGSEALQQQLLAMLVNYVTKELRAEIQYDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMA8B Human Gene Knockout Kit (CRISPR)
KN213508LP 1 Kit

PNMA8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), Biotin conjugate, 0.1mg/mL
BNCB2730-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trmt112 Mouse Gene Knockout Kit (CRISPR)
KN518261 1 Kit

Trmt112 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BNIP5 Human Gene Knockout Kit (CRISPR)
KN418727 1 Kit

BNIP5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2'-Dipyridylamine
TRC-D492740-2.5G 2.5 g

2,2'-Dipyridylamine

Sign In for Pricing
View Details
DCUN1D4 (NM_001040402) Human Over-expression Lysate
LY421741 100 µg

DCUN1D4 (NM_001040402) Human Over-expression Lysate

Sign In for Pricing
View Details