Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii ORM1-like protein 3 (ORMDL3)

This Recombinant Pongo abelii ORM1-like protein 3 (ORMDL3) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 3

UniProt

Q5R570

Expression Region

1-153

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag
057900-01 10 µg

Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag
057900-02 50 µg

Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag
057900-03 100 µg

Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag
057900-04 200 µg

Deoxynucleotidyltransferase, Terminal (DNTT), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Research Grade Acazicolcept
DHC83404 100 μg

Research Grade Acazicolcept

Sign In for Pricing
View Details
FRA10AC1 Rabbit pAb, PerCP-Cy7 conjugated
orb2856095 100 µL

FRA10AC1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details