Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii ORM1-like protein 3 (ORMDL3)

This Recombinant Pongo abelii ORM1-like protein 3 (ORMDL3) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 3

UniProt

Q5R570

Expression Region

1-153

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sfrp1 Pre-designed siRNA Set B
SI212733B 1 Each

Rat Sfrp1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
YES1 Antibody
MBS9216879-01 0.05 mL

YES1 Antibody

Sign In for Pricing
View Details
YES1 Antibody
MBS9216879-02 0.2 mL

YES1 Antibody

Sign In for Pricing
View Details
YES1 Antibody
MBS9216879-03 5x 0.2 mL

YES1 Antibody

Sign In for Pricing
View Details
USP50 Polyclonal Antibody
MBS9245533-01 0.1 mL

USP50 Polyclonal Antibody

Sign In for Pricing
View Details
USP50 Polyclonal Antibody
MBS9245533-02 5x 0.1 mL

USP50 Polyclonal Antibody

Sign In for Pricing
View Details