Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 122 (RNF122)

This Recombinant Human RING finger protein 122 (RNF122) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

RING finger protein 122

UniProt

Q9H9V4

Expression Region

1-155

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFI SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCL VKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038065-01 0.1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038065-02 0.2 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038065-03 0.5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038065-04 1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038065-05 5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038065-06 5x 5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details