Recombinant Candida glabrata Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)
This Recombinant Candida glabrata Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17) spans the amino acid sequence from region 31-186.
Product Specifications
Product Name Alternative
Presequence translocated-associated motor subunit PAM17, mitochondrial
UniProt
Q6FJJ0
Expression Region
31-186
Origin
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SDKPEDSLTWTDFFQLRKQERRINVGSSVFTALVGANVSWAYLSTMEIDPTQMIFGFDPL VVVTAGLMASGALGYLMGPAVGSQVFKLTKGNKLAQYNLKNKEFLKHVIQNRVDASSQSF SNPVPDYYGEKIGSVKEYRQWLRDCHAYAKKAKEFL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details