Recombinant Psychromonas ingrahamii ATP synthase subunit b (atpF)
This Recombinant Psychromonas ingrahamii ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A1T0Z3
Expression Region
1-156
Origin
Psychromonas ingrahamii (strain 37)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNINATLLGQAIAFAVFVWFCMKYVWPPLLAAIEDRQKKISDGLTQAERAGKDLELAQAK ASEKLKEAKVQAAEIIEQANKRRNQIVEAAKTEAETERQKIIAQGEAEVEVDRNRVREEL RLKVSALAIAGAEKIIKRSIDKEANSDIIDKLVAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR217482L3V 200 µL
Hist1h2ak (H2ac15) (NM_178183) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details ARP51020_P050 100 µL
LOC388553 antibody - N-terminal region (ARP51020_P050)
Sign In for Pricing
View Details FAB1028J 0.1 mL
Mouse Monoclonal CD30 Ligand/TNFSF8 Antibody (116614) [Janelia Fluor 646]
Sign In for Pricing
View Details 